PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010913848.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 302aa    MW: 34286 Da    PI: 9.2568
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010913848.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.6e-53101361127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv +yL++k++++++++ ++i+ vd++k+ePwdL  k+k +ekew+fFs +d+ky+tg r+nrat++gyWk tgkdke++++
  XP_010913848.1  10 LPPGFRFHPTDEELVGYYLTQKIDKSNFTA-RAIAVVDLNKCEPWDLAGKAKMGEKEWFFFSLKDRKYPTGLRTNRATTAGYWKITGKDKEIFNS 103
                     79*************************999.89**************9899999***************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyr 127
                      ++e +g+kktLvfy+grap+gekt+Wvmhey+
  XP_010913848.1 104 hTSEIMGMKKTLVFYRGRAPRGEKTNWVMHEYS 136
                     677889**************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-617157IPR003441NAC domain
PROSITE profilePS5100557.51410157IPR003441NAC domain
PfamPF023656.5E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEGEAKEQVL PPGFRFHPTD EELVGYYLTQ KIDKSNFTAR AIAVVDLNKC EPWDLAGKAK  60
MGEKEWFFFS LKDRKYPTGL RTNRATTAGY WKITGKDKEI FNSHTSEIMG MKKTLVFYRG  120
RAPRGEKTNW VMHEYSQQSK TTFEDQKEWV VCRVFKKSSR ERMCLSNQPQ PDQKLQKSSA  180
CMSSVMQTNP YELTSSRNSS TELTRQYRGM LGLSPLIQPQ FGSAGSFTPS SALSLFHPTV  240
AAMEAWTDRI LPNSDIGFGS DIGYAPAKVW LPQVDSNVEL ENYCPPRLSG KETRESLIKP  300
SV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-501015917167NAC domain-containing protein 19
4dul_A6e-501015917167NAC domain-containing protein 19
1ut7_B6e-501015917167NO APICAL MERISTEM PROTEIN
1ut7_A6e-501015917167NO APICAL MERISTEM PROTEIN
1ut4_B6e-501015917167NO APICAL MERISTEM PROTEIN
1ut4_A6e-501015917167NO APICAL MERISTEM PROTEIN
3swp_D7e-501015920170NAC domain-containing protein 19
3swp_C7e-501015920170NAC domain-containing protein 19
3swp_B7e-501015920170NAC domain-containing protein 19
3swp_A7e-501015920170NAC domain-containing protein 19
3swm_D7e-501015920170NAC domain-containing protein 19
3swm_C7e-501015920170NAC domain-containing protein 19
3swm_B7e-501015920170NAC domain-containing protein 19
3swm_A7e-501015920170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010913848.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
SwissprotO040171e-74NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLM0TJ056e-96M0TJ05_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P19680_0012e-95(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5075022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.23e-83NAC domain containing protein 38